PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_34969.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 109aa    MW: 12856.9 Da    PI: 10.1269
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_34969.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1362.5e-4239636129
                      NAM  36 evdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121
                              e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ kg lvg+kktLvfy+grap+gekt+W
  Rsa1.0_34969.1_g00001.1   3 EADLNKCEPWDLPKMAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGCLVGMKKTLVFYRGRAPRGEKTNW 88 
                              78***********9999999***************************************9************************** PP

                      NAM 122 vmheyrle 129
                              vmheyrle
  Rsa1.0_34969.1_g00001.1  89 VMHEYRLE 96 
                              ******85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.041109IPR003441NAC domain
SuperFamilySSF1019411.31E-42397IPR003441NAC domain
PfamPF023653.5E-181195IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MGEADLNKCE PWDLPKMAKM GEKEFYFFCQ RDRKYPTGMR TNRATESGYW KATGKDKEIF  60
KGKGCLVGMK KTLVFYRGRA PRGEKTNWVM HEYRLEGIYS YHNLPKTAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-3619549142NO APICAL MERISTEM PROTEIN
1ut4_B3e-3619549142NO APICAL MERISTEM PROTEIN
1ut7_A3e-3619549142NO APICAL MERISTEM PROTEIN
1ut7_B3e-3619549142NO APICAL MERISTEM PROTEIN
3swm_A3e-3619552145NAC domain-containing protein 19
3swm_B3e-3619552145NAC domain-containing protein 19
3swm_C3e-3619552145NAC domain-containing protein 19
3swm_D3e-3619552145NAC domain-containing protein 19
3swp_A3e-3619552145NAC domain-containing protein 19
3swp_B3e-3619552145NAC domain-containing protein 19
3swp_C3e-3619552145NAC domain-containing protein 19
3swp_D3e-3619552145NAC domain-containing protein 19
4dul_A3e-3619549142NAC domain-containing protein 19
4dul_B3e-3619549142NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413571e-135KP641357.1 Brassica napus NAC transcription factor 87.1 (NAC87.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625819.13e-76PREDICTED: NAC domain-containing protein 92-like
RefseqXP_013681854.13e-76PREDICTED: NAC domain-containing protein 92-like
RefseqXP_013738785.11e-76PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ29e-63NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D3B1S33e-76A0A0D3B1S3_BRAOL; Uncharacterized protein
STRINGBra006449.1-P1e-75(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22692775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.18e-76Arabidopsis NAC domain containing protein 87